dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D1CF47 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D1CF47|D1CF47_THET1) LOR/SDH bifunctional protein conserved domain protein {ECO:0000313|EMBL:ACZ41553.1} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_0636 OC=Bacteria; Thermobaculum.
Sequence length 450
Sequence
MQGQNNGRSSLPFYKTIELRGHIIDSHILSQVMDLVMDYNAEFYIEQFEVGKHKYDPSYA
RLILYAPTPETLDELMEAVTKLGAQLLESEEVDARTEPAPKDGVLPEDFYSTTNMPTEVR
IDGKWFPVENIEMDVAIAIRLNEEGKPIGAYTVPMSDVRKGTPIVVGHQGIKVSPIERPR
SPALLGSPSRASQGHVFSFMSSAVSTERPKAAAIAEIAQRMREIRDSGGTTLVVGGPAIV
HTGAGPQLAALIRHGFVHLLFAGNALAAHDIESAFFNTSLGVSLDANSEGATYEHGHEHH
IRAINKIRYYGGIRQAVEAGVLKQGIMYECIVNNVPYVLAGSIRDDGPIPDVITDVIEAQ
RAMRRHIQAGVDLALLIGTTLHSIAVGNLLPANVLTVCVDINPSVVTKLLDRGSLQTAGL
VIDAGGFLRELCYQLGLREKSSIDSPTKVQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]