dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D1Z0B0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D1Z0B0|D1Z0B0_METPS) Uncharacterized protein {ECO:0000313|EMBL:BAI62132.1} KW=Complete proteome; Reference proteome OX=304371 OS=SANAE). GN=MCP_2060 OC=Methanocellaceae; Methanocella.
Sequence length 334
Sequence
MGDWTAALNGYPIDWLLEEDNPSVRYFTLTGLLQKPVNDPEVVSAKRSLMMNGLIPSILA
KQEAAGYWGMPEDFYVRSKYKGTVWTLILLAHLGADGSDPRIKKACEYILDYSQDRESGG
FSYRRFRGAAYRDGLLPCLTGNMAWCLIRFGYLDDPRVQRSIEWITQYQRFDDGDGSPSG
WPYGKHEACWGRHTCHYGVVKALKALAEIPPRKRSKPVKATIEAGAEYLLKHRIYKSSHD
PEKVTMPGWLKFSFPRMWSTDALEVLGILARLGYRDERMQDAIDAVLEKQDAQGRWLNED
RYGSRYIMRVDRTGRPSRWVTYEALHTLKLLKFP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]