dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D4KLK8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D4KLK8|D4KLK8_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CBL07760.1} KW=Complete proteome OX=657315 OS=Roseburia intestinalis M50/1. GN=ROI_04650 OC=Roseburia.
Sequence length 1153
Sequence
MKKRHQAGKRIAAWLMALSLCMTAVPAEQVVYAAGGQNETEVTELTELTEVPESAEAMKD
SETTEKTGAGEKAETEEAGTESKAEVTETTESEETSEIPADTESTESSEIPADTESTESS
EIPAGTESTENSEMPTDTESTEIPETTENTESTQATEDSEMTDDTESTEALIGDTEAADT
EKEESEDILKKDGNVTPGSTYAAATSIGLNTTYNATTSRTSVTHWYKFTMSKAGMVQLKF
AHVNLSSASNSTAWRIDFIADQVGGLVTVTSGMQDTQNQTAKIGLDAGTYYVQITGTGVL
TVGSAAYSFSVQYEDTYCETEQNNTIATADNYDRLGQTITGSISSASDTDYYKITSTTKG
YLSFQLQHDKVSGRLSTDIYSVAVCDAAGNTMYTMTSKKDEEKTESVNFGLDAGTYYLKV
SGIQYMDASGSLTVQGANGETYKLKASWTNADNWESESNDDINTADTMTSGKAVYGSLYG
VSDSDYYGFQTTKDGYIVINLQHSKVTGRQNKAIYAVTVCDTSGNSIYEMTSKAEDESTD
SIKLGLSAGKYYIKVAGQNAYYGGNYVIKTTFKACSTWEHESNDTYDTANTAVSGTTYSG
DIRTYSDVDYFKTSLSANGYINVKLTHPVVSGQETTNMFVLSVIRKVDKDQYTEVYTTKI
RGGDTSISTPNLGLPKGEYYIKIAGTGNTTGTLLSGTSYPVNYDVCIIAKTASDREVESN
DSAATANTVKNGKTYYGSTSSSSDKDYYKIKMSKAGYLQIKFGHKNSQSTASCYNVVLYN
KDNSEIYKFTNTGTETSYTSCKLGLDAGEYYVCVSQASTLYTGDYTICMTQKAASGWETE
NNGDWASADNIKVGKAVNGVITGYTSDEDCYRFTLTKAQYINFSLAHEKINDAGRSWYVT
LYNANGKRVSRKDDDHIYSYAGSTYTESKAVKLSKGTYYLKVQAFAKNAVEKEYTLCVNK
IENRKTSVTSVKSTAYNKLKVSWKVVPAATSYQIYRSTAKDGDYQNIKTINSVGTSSWTD
GSVKTGKTYYYKIKTVVKTQNGEQTSGFSNVKSAKAVPAKTTLKAKASDAKNVKLTWSKV
KGASGYEIYRSNSKDGKCSKVKTISKGSTTSYKNGKLKKSTTYYYKIRAYRKVNGKKVYG
SYSSVVSVKTKAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]