dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D6EMT0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D6EMT0|D6EMT0_STRLI) Uncharacterized protein {ECO:0000313|EMBL:AIJ16786.1} KW=Complete proteome OX=457428 OS=Streptomyces lividans TK24. GN=SLIV_29435 OC=Streptomyces.
Sequence length 333
Sequence
MIELEGVPELVDPVMVAAFEGWNDAGDAASTAVAHLDREWKGEVFAALDAEDYYDFQVNR
PTVFMEDGVRKITWPTTRLSVVRVGGDKPRDLVLVRGIEPSMRWRSFCNELLGFAHELGV
ELVVVLGALLGDTPHTRPVPISGTTSDADLARRMDLEETKYEGPTGIVGILQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLIGVRVPLGELPEDARAWQVGVDQLAAED
TEVAEYVQSLEEARDTAELPEASGEAIAREFERYLRRRDGAGPGGPGGPGGHATADGGDG
PAGAPFRRDNPSGRARPPKPPKAGGDDEESSED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]