dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D7BUT3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D7BUT3|D7BUT3_STRBB) Aminoglycoside phosphotransferase {ECO:0000313|EMBL:ADI03274.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_00153 OC=Streptomyces.
Sequence length 299
Sequence
MAIGRTADPRPAIDAALARCLVDTQFPQWAELPLELLDPAGSDHVIYRLGKDLSVRLPRH
AGAIRQAVKEFEWLPRLAPHLPLAIPVPVGVGEPDFDYPWPWAVSRWLDGEVATAEALAD
SSRAAVQLAEFLTALQEIVPEEFPVEDAREDLTGRPLADRDRATRAAIGEVDGTFDTAAM
TALWDAALSAPGWDRPPVWFHGDFHTGNLLTVDGRLSAVIDFGGLGIGDPACDLTIAFTL
MSAGSRAAFRAALGVDDATWTLGRGWALATGLNAYTSYAAVNPRVAAQTTRQITAALIG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]