dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D7C2U1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D7C2U1|D7C2U1_STRBB) Uncharacterized protein {ECO:0000313|EMBL:ADI05974.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_02853 OC=Streptomyces.
Sequence length 1410
Sequence
MAGSAAREGRGGGRPGALGRLDDALALLADSGAQLSQEQLLDALWLATRLPAGAAGSAGT
AGAGAPLERARTAATSSDATSATSPAPASRPPGPAADRPRPSVPAASPPSQQTPSRQTPS
RQSGPIDSTSGLYGAIEAPPTPAAPPPPAARRALPLRVPEAKALRAELSIGRALRPLKQY
RSNPLKREVDEVATATALAETGLPDVVTRPARERWLDLALVVDDGMSMLLWRRLAVELRT
LLQRAGAFRVVRVLGLHTRGADAPVLRAKPYVPEAPTLPVTAVSDPSGHTLVLVLSDGVG
AAWRDGRMSAVLERWAGLGPTAVMHALPPRLWEGSGIRAQRWQVRTRRPGSPGTDWTVTD
PVLPPELARFDGLPVPVLEPDAGPLADWARLTASASSTAVLPLLAPPRPPRPRRPAAARS
APARPADDLSRLMRFREAASPEAYRLAAHLAAVAPLPVPVMRLVQTAVEWQADTGHLAEV
FLGGLMRPAEPPASAGPGPFPPQQRPFTFADTVQRALLGAVPLPELNQTRELIGRRLKEL
AGKSPDFPAWLAHPSGADHLPARARPFGTVEQRLAARLGAPPAPPTPPALTRLLTTGRWR
PLTPEDPRTIGPYTLRMADPSGFRVTTYIGDEDAYGEQVVIHTAFREHAPHAAEVLRVQA
EALRRMDGRYAARLLRQDLDCPTPWIAEEPFVAERLSDIPLSSDADRAFAVARQLADAVR
VCAAEGMTHGDLRQGTVYVSDDNELFLTAWSSACIDGVPSPALVGGPRTPEDNVHDLAEI
LLDLGGGAHFGADSEPYDLSHWRGVWRSVRDVVLACLAPDPGDRPTAREVWEAFERSDPA
TPPPVPVPEPVAESAPELAREQRAHGWTPLSDQDPRWLGPCALICHIRTHSGTTAYVGQG
PNGESAVLRTVNEESGRRGAFAELSTEAEALRRMAGRYAPRLLGQDLEGEPPWIAEELIL
ASDGSPARTLTALLSDGTADGWDARTAAVLGMQVGEAVSICSAKGMVHGHLNTDTVLVAD
NTVKLIGWQTAVIDRRSRRLTRRLTPEDDVYALGQILLALGGGRPTTREERWLNPLPQNI
GTPSGTYASKSVDWTGSRWEGAAWEPLRTLVASCLFNPRRNRPTAGEVSDVFSQVVARTA
AQGVRPDAGGQALKHRLIRAPLLLFHRIAVLGLSRGTEAARTAAALSAVFASARPDPVIA
VDVSPDTGWLIHRSHRETDTGLRELATLLPGALARAELRRFTSRTPDGLEVLASLAPPDR
PIDDQDYRRIMNALSERYPLALTHAAASPGTGEITLPGVLDLADQLVIIWSAESRRRPTN
VDATFDWITAQGHAELLRRSIVVITGADNFNPLEHTELVPQGECRAMMAIPYDPHLASGQ
PLDLGALRPGTLARYRDLAACLAEGFVGAD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]