dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D7CA47 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D7CA47|D7CA47_STRBB) Phosphotransferase {ECO:0000313|EMBL:ADI04375.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_01254 OC=Streptomyces.
Sequence length 157
Sequence
MSMFSTLVGADRLRDHDDLQLDEPAEHHLCHGLPVLASDVAQDRVREEVVPAFGERPPRL
DRHTALRALHEQLPVADCPFSWSVDHRLGIARRAGIEVPADLPEAPPVDHLVVCHGDPCA
PNTLLPEEGSWSAHVDLGALGVADRWADLAAPPGVPT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]