dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D8S445 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D8S445|D8S445_SELML) Multidrug and toxic compound extrusion protein {ECO:0000256|RuleBase:RU004914} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_417928 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence length 1249
Sequence
MAAASSSKPSKATGSKVPSFTARNPAAPAAFPDAGDLLAKSPTTKTRKKSHSGDVCASSA
PALAGVLHKWVNYGKGWRPRWFELEDGILFYYKIHGPDKICVHNEQIKASKIIGDESRKL
LKKPKFCSQGEERQHRRTFGEVHLKVCSLRESKSDDRKFYIYTGTKTLHLRAESKEDRTA
WMDALRTSKDLFPKDMSSLSYPPPADNIKISTDALKEHLVKLGVPEQGIKECEKIMMSEF
TKIQHQLRVMQQKRLFLIEKIRLLEADKLELETTVVDEMQNNASAGAGNVVGALKDHGIK
THSFLRLLGADESESDEDIRQEVVEAESDDEDFFDTRESLSEAYLESAVFNTTVELIENE
DVSSNGPSGEDVVYPSVKRRTRLPEPKEVENCVSLWSMIRDNIGKDLSRICLPVYFNEPL
SSLQKCFEDLEYSQLLDRAREYGQKGNRLMRILYVAAFAVSGYASTEGRHCKPFNPLLGE
TYEADFPDKGVRFIAEKVSHHPMVIACHCQGRGWELWGDSTLKSKFWGRSIQLDPVGVLT
LQFDDGETFQWSKVTSSINNIILGKLYVDHYGTMRIQGNRGLSCKLKFKEQSMIDRNPHQ
VQGYVHNEGGDKLASLIGKWDESMYYVLGDPVSNARGYDPMDTATLLWQKNPPAEFPTRY
NLTAFAITLNEITPDLKEKLPPTDSRLRPDQRYLENGEYDLANAEKQRLEQKQRQARKLQ
ETGWTPRWFKRGSDQGTYRFMKTYWEARKLGQWQGSFLFFFSLLPANCIDLRDAARFVGV
ERLPEPANCAGVANSTGASEGMVGLLWEIAAIALPAAFALAADPLSSLVDTMFIGRIGSV
ELAAVGVSISLFNLVSKVFNIPLLTITTSFVAEDKASSLESSFSEEKQASVAKDEDPPQQ
PRVQLPAVSSSLALGLILGLAEAALLAGGSSQVLKIMGVPPHSDMFVPAKQYLLLRSIAS
PAIVVSLAIQGMLGNVVHIALDPVLMFTLRLKVYGAAAATVISDYLILLVLLYKLNQSVV
LFPLRLRWSFFGRFFRSGGLLLLRTIGTLLTMTFATSLAARLGANPMAAHQICVQIWLAA
SLLSDSLALAGQAIVAEGLANAEYDKVKLAAYRVLQIGFGFGVLVCLLLFLVSQWLLRMF
TRDTEVLEIVNIVLPFVIATQPINSLAFVVDGLYFGGSDFAFSAYSTICIGAASLVPLFL
GSLWWGLPGIWIGLSFFMCLRLITGLLRLGTASGPWRFLKGDYKMVLPV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]