dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D9HNU6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D9HNU6|D9HNU6_MAIZE) Auxin response factor {ECO:0000256|RuleBase:RU004561} OX=4577 OS=Zea mays (Maize). GN=ARF19 OC=Zea.
Sequence length 716
Sequence
MERERESDRCLDPQLWHACAGGMVQMPAVHSKVYYFPQGHAEHAQGPVDLPAGRVPALVL
CRVAAVRFMADPDTDEVFAKIRLAPVRPNEPGYADDAIGAAAASGAQEDKPASFAKTLTQ
SDANNGGGFSVPRYCAETIFPRLDYSADPPVQTVLAKDVHGVVWKFRHIYRGTPRRHLLT
TGWSTFVNQKKLVAGDSIVFMRTENGDLCVGIRRAKKGGIGGPEFMHHHHQQPPPPQGGG
YAGFSMFLRGEEDGGKMMAAAATRGKAARVRVRPEEVVEAANLAVSGQPFEVVYYPRAST
PEFCVKAGAVRAAMRTQWCPGMRFKMAFETEDSSRISWFMGTVSAVHVADPIRWPNSPWR
LLQVAWDEPDLLQNVKRVSPWLVELVSNMPVIHHLTATPFSPPRKKLCVPLYPELPLEGQ
FPAPMFHGSPLLGRGGAGGPMCYFPDGTPAGIQGARHAQFGISLSDLHLNKLQPGLSPHG
LHRQLDHGVQVQVQQPRIAAGLIVGGHPAARDDVSCLLTIGTPKSKKPPSDVKKASTAAA
PQLMLFGKAILTEQQISLGGGNVVPALAKKSPSDDDDDVAERTVSNSDVSSPGRSNQDGT
SSGGGPAARACWQEEECNNRAAGSEDDLLGHCKVFMQSEDVGRTLDLSAVASYEELYQRL
ADMFGVDKAELTSHVFYRDDASGALKHPGDEPFSEFTKTARRLTILTDESSDSLAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]