dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D9SVH1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D9SVH1|D9SVH1_CLOC7) Carbohydrate-binding CenC domain protein {ECO:0000313|EMBL:ADL51095.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_1342 OC=Clostridium.
Sequence length 205
Sequence
MGLQFMKKKFKTAVAAVVLASSVTGYNIAKEDDIVALDLKKSSLESMDYSKEKIEDISEN
LVKYGTFSESPECFKHWRVVVDNIAICTYENSNDVFSLEPEDCGNSEDAIQLCQTIDNIE
PGKKYTLNFKAKSTLPKSITVFISDRMDVLSFSKPATYSISDKWTDYTYDFVVSENTEPL
SVLRFYLGRTMGKISFTDIKLNLSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]