dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E0VIB9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E0VIB9|E0VIB9_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB13125.1, ECO:0000313|VectorBase:PHUM225060-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM225060 OC=Pediculidae; Pediculus.
Sequence length 578
Sequence
MVYRFHDQVFNKMTPEKRARNLCVMKALSRDSMRLNKNKENENPLNNNTTPFNLKHSTPI
KYRKITDSNYPERISPVDINTTDSENFLEKKKKDPDEPKLVFAKIYELTPNGETNVIETT
TTTTTTTSRNDYSKSSEFEIIVPEKKLQNGELNSRKKESNWKSLNVLNDVAEYEFCKSLE
QSKLCLSTSNLLEEIEADLPSHYSLAKPLNHTFHSLESYRTVTRLARNDKNLTTIDYVET
DVDEGDEKVLLLKKLDFLEMEATIQKAKIRQAQKAMTLSKNKKSMDVEYFECEKTLLLSG
LRLNAALQEMERLKRSQGTANGCFKDNYGQVTIREIVFYVDDVTLNKDGKLYFDQPMKFQ
NLNKDFVINIQLYKRRGKEGKEPKKIFLMKKLKELAGNTLQKTITTSSVGEKHDFECVAS
TRLKLENVSNRKQDKCVLKFSEPPQHPVMRDALVLYLKTDFNVETKDAFGFLNVFNNSCW
QRWWFSQSGYYLNSWLYPEDEENNKVPVYSLHLPSCTEKVKIADLEVCIRPHSFVVVTGP
PNNKEEILFSAESNKDMIKWMNHLNLIIECVRLWKPNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]