dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E1BJE0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E1BJE0|E1BJE0_BOVIN) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PLCD3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence length 815
Sequence
MLCGSWRSRRRQPEEPLVPAQVATPVGLASPPASQEGNIKRPGLRALKKMGLSEDEDVRA
MLRGSRFCKIRSPTWQKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAIREGHQSE
GLRHFGGAFEPARCLTIAFKGRRKNLDLVAPTAEEAQRWVRGLAKLRARLDAMSQRERLD
HWIHSYLHRADSNQDSKMSFKEIKNLLRMVNLDMNDMYAYGLFKECDRSKNERLEGPEIE
EFLRRLLKRPELEEIFHRYSGEDRVLSASELLEFLEDQGEHKATLAHAQQLIHTYELNET
AKQHELMTLDGFMMYLLSPEGAALDLAHTRVFQDMDQPLAHYFISSSHNTYLTDSQIGGP
SSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVREHAFTVSPY
PVILSLENHCGLEQQAAMARHLHTILGDMLVTQTLDSQNPEELPSPERLKGRVLVKGKKL
PDTRSENGCILSEREEEDEEEDEEEELGAVEQRRRAKQISPELSALAVYCCATRLRTLRP
PPVPPQPCQVSSLSERKAKKLIREAGNSFVRHNARHLTRVYPLGLRMNSANYSPQEMWNS
GCQLVALNFQTPGYEMDLNAGRFLVNGQCGYILKPVRLRSPNTTFDPECPGPPRTTLTIQ
VLTAQQLPKLNTEKPNSIVDPLVRIEIHGVPADCARKKTNYVLNNGFNPRWGQTLEFQLR
VPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATLFVHIC
IRSRATLGSAGASLCPTPALRSGGRDGGPAPPSSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]