dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E1C5Y7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E1C5Y7|E1C5Y7_CHICK) Phospholipase A2 receptor 1 {ECO:0000313|Ensembl:ENSGALP00000032471} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=PLA2R1 OC=Phasianidae; Phasianinae; Gallus.
Sequence length 1459
Sequence
MLGVLLLACCLLLGGRSLPRGDAALSRDELPSLRNKGIFIIQSSGSNLCIKADTAGLVLE
DCSQLSKHMLWKWVSNRRLFNIGRSSCLGLNISRPEQPLTMLECDSNRYSLWWNCDGRAL
VGVSEYRLAVENSKRIVAKKKSDYQWIQYMSYDEDLCEHPFQETYTLLGNSFGFPCVFPF
KYNNKWYYECTRDGKEFEWCATTSYYEQDEKWGFCPGVEHGCGTFWKENPATHVCYQFNP
SAVLSWHEARAACQAQGGDLLSITSPEEQSYLSNLSRQLNTTDAVLWTGLNRLEEGAGWQ
WSDGAPLVFVNWKADVSEDHSSENHCAVMSSKLKYGWKSYLCESGLPFVCKKYLNKIEQE
TLDTWKYYATRCDAGWYPYNRYCYRLHKEAKSWNDALISCQSDNSGLISISSMADAELLH
NLLQRENITETWIGLYSSNISVVFEWSDGTPVKFSYWHSQEPNTFQRTGQLCVSAQGPEG
LWKVKKCEDKSFYICKKAGEFNSVSSDAESSCPEGWERHGGYCYKIDSTPRSFEHASSGY
FCPSALVSVTNRFEQAFITSMIRSVVKSERTYFWIGLQDLNNTGEYVWLTKDGKNHSVSY
TNWNKHQPRHSGGCVAMRGQDPVGYWEVKSCKNFKAMSLCKQKISSYEEPELTFQRHLSS
CYFGWESEGNLLNCYKIFHREKILMKRTWSEAETLCQDFGAHLASFSHVYEETFLNNLLY
TIFDRTEERQFWIGFNRRNPFSGGTWQWSDRTPVVASFLESKYVEDDSRNCGVFKVNRTI
FPAHCNEKREWICKIPKGVKPKNPDWYIAELPWSYYQGAEYLFHVNPTDWDTYEFICVWL
RSEMATIHSADEQAFIENKIKKLSDSDVHWWIGLHAESISNEFRWKDGSQITYQNWNEGR
DRYLRKPGKRCGFISSQTGRWDDENCTVSLPCICKRKSAWKIEKEIPKDQNPQGTCPKGW
LHFGYKCFLIQIPKDPEHLRSWYSAQTFCSRYDGSLASLEDELEQAFITMNLFGRKTSVW
IAFQGDDYEKWMNENPPRYSNWSPIEAVHRPRYNGVYVEEQVPLCTLVSNNPNFYFTGKW
YLENCEKNYGFVCQKGQDTSRHIVNASEMYPVPDTLQYANRTYTLIRGNFTWSAALKACM
ANGAELVSIADQYHQSFLTIIVNRLGYNHWIGLFTADNGLNFEWSDGTRSLFTFWEDDES
QALGSCVYMDTSGRWKSTSCERLLPGAVCHVPPKKKLTEYKGLCSENNVPWIKFKNSCYS
FNTVLQGTSFDTAYEVCRNQGSNLLTIKDEDENAFILEELHSFGYSVKMVWLNILQVTDN
ETVSWFDGSPLNYSNWGIREPEFDHLKGNFCISLRTADGVWQISPCREIKGFVCKKDADL
DAAEPSKKQSYPGLAALAVFVTLVMLAAISFFLWCLYKQNNRFFHRILWVRNAYFPQINS
DVPALEESILISDFERDDN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]