dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E1JH51 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E1JH51|E1JH51_DROME) Suppressor of zeste 2, isoform B {ECO:0000313|EMBL:ACZ94409.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3905 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 1368
Sequence
MHLQNTHNTMESNAAMDAASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCI
LKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQHDL
VDEQTTDEPEFFTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRFLCS
KYNIETDNGLVEVEVTYKDEVLPTNFTLMDVAYCYNWSRESPMAFCYRILLYDNEQTKND
ENNLSRINQDIEPEHSVRRSKSAKSVTFAEDLESEIDSGSPRSKVRCKTPPKVSPSSKNK
RLTSSKREAEPESPVSNFKSLRSNDMRYSDYAVSKVKSEPEQEQFLLPREREQQPLEANT
NIVVSIPPSQLRKSYVDAEDFELKTANRKGVGHLPKLKIELNSMKSKLSMPLSAGPRLED
TSCSLSCSAQQLDLETYAKNIGLKPIEQPLQQSASNPDSKYSPNASPMSSCSSSTNGSSS
SLGTADASTSTSTSSSHRKRKKKHSKEPKDANGKRKKLHAEISSQTDGKMKVKITAKPNH
KLDFKRSHSLASGELDLQKLKLDSTSTSEALNRTLGEEARSINSLVVGGAPTPPPTPTAE
PEQQQQQQQQQQQPQQQQQQQQQQQQQQQFVVLPKIKDLTLPTSPPLPPSLFKAYTPSTT
PTAPHTVAGGKPKQQQQQMPQQPQAVLQQSLAKTNPAKPPLSSNNNRKPNSGHFAVPQAP
THRNMYHMQRYQSTPSSIASAANKMPKRSMSLDESHPAKQARLSQAQAMASSYAAKLHMQ
TSNQAKSQAAAFLPNPQMRSYGLPDLGSKPTLPMLCPASSSSQVTITPRPRATPSIYSFS
EPNIHVPALEIVRLPVNKQSAGGKGLTMPPLSPPATSSARLMGPPAALPKHAGHGHGAAK
RSCQMPTMPMPLPLPLPMPMTTIPAIVKSPPLSVALSGQRNNKGNSSNSNAYRTSPPALI
NLRNTAAPQHSFPSKSSPKVEANSKKSPPAAGCQGKTNGTAALDKSKTSLREFRPAVQSA
VTATATTSVTTAAGAGAGAGTGTGTALAKDADILDLSANPGRSNNDAKLAPNSPPAGNNN
NNNNNNNNNNNNNNNNNNNSTSNSLEAALNKIKQNISANSNGGPSTTSGSNSNGTTNGDD
LQNLHMLSESATAREKISIKAASSGNGSGSTSSSSAKPKNANALVRPQNASVRSIPNPSA
LAFRNQPAAASTAASISKPLTVRAEEKPKVSTSNPGSLSPTNTSSSSSSSSSGSSGCSAA
TSPRAMTKKPTTIDQVAANLNIRAEAKAAALAEEAPPVLSSNAAKSPELAKTTTAVALRP
EPKETPITVSAASTLLTIPSAVSSVSAVPETMAKPPVQIANAPVASSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]