dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E1QX06 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E1QX06|E1QX06_OLSUV) Proteinase inhibitor I4 serpin {ECO:0000313|EMBL:ADK68659.1} KW=Complete proteome; Reference proteome OX=633147 OS=NCIMB 702895 / VPI D76D-27C) (Lactobacillus uli). GN=Olsu_1560 OC=Atopobiaceae; Olsenella.
Sequence length 451
Sequence
MERPIERRTALALLGLPLALSLGSSLAGCGVGGNPDDVPPLLAASDLTAGVGDSASVRGA
QAPIGDTLTDQAATLAAYDFAARLLQGCYKAEPGGNVLVSPLSALFALALAENGAAGETL
SQMEAATGMGVRDLTSYLEAYARRIGGEPLYDTQGTGEALALRSANSVWLRDSGGLSVTD
DYLATCKDDLFAQAFSAPFDETTRRDINSWVSSKTDGMIEGMVDEISDEARLFLINALAF
DGAWSDPYKDDDVRDDTFTAVDGTGQDVRMMRSHESHYLENGFAEGFMRPYENHDFAFVA
LLPKGGVGIGDLVGSLDGGSLHELVTGAVPDVEVSAGLPKFTASHRTLLDEQLHSMGMLD
AFEPSLADFSPLGSVPDGNLAVGSVIQKTFVDVNEQGTRAAAATSVEMETTAARPSDPEV
REVVLNRPFVYLIIDYQSATPLFAGVVTSMA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]