dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E6UFX8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E6UFX8|E6UFX8_RUMA7) Dockerin type 1 {ECO:0000313|EMBL:ADU23652.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_3189 OC=Ruminococcus.
Sequence length 444
Sequence
MYNVKYYYILIICKKQVRIEYKRKESGFMKMKRVATGLCALMMVFGGAVVPVVPIGTDTV
VNASADSVYGSFNYIVFGDNTVEITGYNGSAANVSVPSSINGKTVVSIGKYAFDNNHSVK
SVTLPSTIKSIGICAFFYCANLQSINLPSGLKEIKEEAFMNCISLRSVAMPNTVTKLESS
AFCGCESLSSLTISSGLKAIPDYAFEECGALRNVTVPSGVTKLGIHAFGKCKGLESISLP
STLTFIGANAFYLCSRLKSISLPDNITSIEANTFIDCVGLASVKFPSKLKEISIDAFNGC
ISLRNVQLPSSLTTIWYDAFYGCTAMGTVTIPKSVTKISPDALGFYDNGKIKGFKMRVYK
GSAAEQYAKENGLAYEVISTASKSKGDINGDGSVNVSDISKVAAHIKGKKTLGTSNKADL
NGDGRVNVSDISLLSAYVKGKKKF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]