dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E7LWG4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E7LWG4|E7LWG4_YEASV) Bud4p {ECO:0000313|EMBL:EGA78228.1} KW=Complete proteome; Reference proteome OX=764099 OS=Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). GN=VIN13_2686 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence length 1447
Sequence
MHDAESTVDSLLKEIDNEMEQTKSNITQNGSEDTPHNWKLPLQEIGDGTMEMLVKHNTRS
NATENSRGRSPSKMSTISNESLNLGLLRVNSELEESPAAVHQERIKNSVANGALGHANSP
KVLNNLKNMAQDIDKLARDEEKPVKLSSSPLKFTLKSTQPLLSYPESPIHRSSIEIETNY
DDEDEEEEDAYTCLTQSPQILHSPSRIPITNAVSINKLNLDFTLNPNESDKSLVSDTSVD
STGRELDTKTIPELPFCMSSTPEMTPVDEKCNLPSKLLNTSNNSHSDSRSPTASVEDLNI
STNLPGADSSQNNPVTTDADALIENDVVRDLQQNMEHIDDAFDEKKVLDEGCSNEPVTFL
GENDTRSIVYSNKGTNANVQEFSQEDSLAHSEPNFKDLNATSDDVWNEDKETDANISTST
KSEESYIADYKVTRQEDWDTKKLHQESEHANEQPAIIPQKDSSEETFTELNNESEFQRNS
KDGEEYRIVQHEESLYGQRTKSSEENIINGSEIGVDHGEAAEVNEPLAKTSAEEHDLSSS
CEDQSVSEARNKDSIEEKEVETKDENIETEKDESEYHKVEENEESEHVPLLPPLPRWEEI
QFNEPFIDENDTSNDSIDLTRSMKPSDYISIWHIQEEEIKSNSPESIANSQFSQQSSITT
ASTVDSKKDNGSTSFKFKPRIVSRSRIYNPKSRVSSLNYYDNEDYILSNSEWNALDPMRR
NTLISKRIQDNIRTQKGHAPLIRPSVMKLNGEDSGFQNHFLEVEQPQEHENIPLSTHLSE
QDITTNVGPDEQKLPTNTQDEAEISIREIESAGDITFNRGDLLSLSFDEELGQDFANFLD
ALDHDSTSFNHGPDDSSSFQRDSSKKSFNSLWESSYELKPPPSIRKQPIAPDVLQKLLES
DTKDDADLEKIREERITEPRTGLGIGMLKTPVKDVSIALAASIKGYEASFSDTDSRPEGM
NNSDAITLNMFDDFEEDKMTPSTPVRSISPIKRHVSSPFKVVKAGNKQENNEINIKAEEE
IEPMTQQETDGLKQDIPPLLAQTKDNVEAKEETITQLEEPQDVEQEFPDMGTLYLSIKAI
STLALYGTKSHRATYAIVFDNGENVVQTPWESLPYDGNIRINKEFELPIDFKGKAETSSA
SSERDSYKKCVITLKCKYEKPRHELVEIVDKVPVGKSFFGKTKYKFEKKYVQKKPKQDEW
DYLFAQDGSFARCEIEINEEFLKNVAFNTSHMRYNMINKWSRIADKIHGSKRLYELPRKA
PHKVASLDVEACFLERTSAFEQFPKQFSLVNKIVSKYKLQQNIHKEGYLLQDGGDLKGKI
ENRFFKLHGSQLSGYHEISRKAKIDINLLKVTKVLRNEDIQADNGEQRNFTDWVLFNECF
QLVFDDGERITFNAECSNEEKSDWYNKLQEVVELNVFHQPWVKKYCEKLAEEEKTRTTGH
NLKQDFN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]