dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E7TBC1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E7TBC1|E7TBC1_SHIFL) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome OX=945360 OS=Shigella flexneri CDC 796-83. GN=SGF_01844 OC=Enterobacteriaceae; Shigella.
Sequence length 142
Sequence
MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVIT
VYADRSFTFVTKTPPAAVLLKKAAGIKSGAGKPNKDKVGKISRAQLQEIAQTKAADMTGA
DIEAMTRSIEGTARSMGLVVED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]