dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E8WFU2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E8WFU2|E8WFU2_STRFA) Peptidase S8 and S53 subtilisin kexin sedolisin {ECO:0000313|EMBL:ADW02540.1} KW=Complete proteome; Reference proteome OX=591167 OS=Streptomyces pratensis (strain ATCC 33331 / IAF-45CD). GN=Sfla_1086 OC=Streptomyces.
Sequence length 1216
Sequence
MLPAAGPATAAPEPSATRDRPVPDVRAHAITLVTGDVVHWTDGVGGQDTVTVDRPEGATG
GVHVRQAGEDLYVIPDEASALLAAEKLDRRLFNISTLVEMGYDDRRSGGVPLIATYAAGT
GRSQPTAPRGSTKVRTLESVHGVALKAGKDDARAFWNDITRTRKSRSLDGGIAKLWLDGK
VEAALKDSVPQVNAPQAWAEGFDGKGTTVAVLDTGIDATHPDVKDRVKQSRSFVPGEEVV
DGNGHGTHVASTIAGSGAASDGANKGVAPAADLIVGKVLSNEGSGADSGIIEAMEWAKAE
GADVVSMSLGSSIPDDGGDPMAQAVDALSADGGPLFVIAAGNAYGAGTIGSPGSAASALT
VAAVDKQDRRADFSSMGPLVRSYGLKPDLSAPGVDINAAASQSVPGIDGMYQSMSGTSMA
TPHVAGAAAVLKQRHPEWSGQRIKDALMSSSKLLPDHTPYEQGTGRLDVKAAVDTTIEAT
GSVEVASYDWPHSAQDAVAERTLTYRNTGDEDVTLKLATDTDAAAYTLSTPELTVPAGST
AAAVLSIDPSRIANDTRFSGQVLATDPSGATVAHTGFAVNKERELHDLTLRLRDRAGEPM
DGTVVLAALGDTELGLVQVSGETTLRLPPGNYTAWTSADVDGDRSDSKAVAFLSAPETIL
DKATTVTLDASKARRVSVRTPQETETRQLRYDMARTSPEGVVQRDAYQIPLTYDQLWASP
TKKVTQGDFSFLTRWRQGEELIDLTADGHDVPVTVQSGSSVAEDSEQKLTGVFAGNGAAA
DYQGRAVKGKAVVVTRSDTVPPAERLANALAAGAKALFVVNDARGVAMESYAPYGEETTI
PVASVRKGAGGTLIEAARHGRKLSVDQRKFASYVYDLVDRHDGTVPDRSLAFAPSARQLA
KVENTFYGHKATLGGGYRYDIPDYGPGIGFEEYEKFPGTRTEWVTPLPGDSFWYENHSVL
NADASDTAHEMRSAELDHTAGRTYRADWFAPVTGPRLGTAYWGPFRTAGNDVQFNITPWT
DSGEGHSGSMPADEYDTTSFAFHQGDTLLKKGAGRAGYVWDLPAGKLPYRLVIDSERDAA
TWKTSTRTHTEWNFLSGALPDGTERADIPLLQLDYEVDTDLAGDVRAGRTIEVGLASGTQ
AWLDGAVKATRASLSVSYDEGASWSAAELRKGSAGRWTAKLRTPAKGASSVSLRAHTEGP
GGLAVDQEIIKAFGLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]