dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E9GEG7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E9GEG7|E9GEG7_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX82261.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_302578 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence length 365
Sequence
MKLIFSLLSIFLLFVNGSGAVECGIANRPFSRIVGGMETKPNEFPWMVYLKVQFWSGDSA
QCGGTLISDRWILTAAHCLYGVVDVTAILGAHDVTNSNSLSRQEFSTKKWNIHPLWSYGQ
VENDIALVQLPVAAVMSDYARPACLPYSDDPNFVDFDVTITGWGNYSSSVDSGTSPVLRS
VRSSIIDSSGTTGICQQKASGEGPFHGDKIICSDSSYNRHFCHGDDGGPMNLYNSYWNTY
TVVGVAWIGDTSVDCSISTKPNICARVSYFIDWIHDTTGIPRIPRPTTTTTTTTPPAPTT
SYFTCEGKPSGIYPNPACDCCTTFYKCSNGYAYLYDCPDAGTVFDPQISVCVYPGNLPAC
GGSAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]