dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

E9PFP8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|E9PFP8|E9PFP8_HUMAN) Poly(rC)-binding protein 3 {ECO:0000313|Ensembl:ENSP00000383159} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PCBP3 OC=Catarrhini; Hominidae; Homo.
Sequence length 361
Sequence
MESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVT
ITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKI
KEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRP
KPASTPVIFAGGQVRADPLAASTANLSLLLQHPPLPAYTIQGQYAIPHPDLTKLHQLAMQ
QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIG
RQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGT
L

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]