dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F1PXD6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F1PXD6|F1PXD6_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000020163} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PRG4 OC=Canis.
Sequence length 854
Sequence
MQWKILPIYLLLLSVFLIQQVSSQDLPSCAGRCGEGYSRDAICNCDYNCQHYMECCPDFK
KACTVELSCKGRCFESFARGRECDCDSDCKKYGKCCPDYEDFCGRVHNPTSPPSSKTAPP
SPGASQTIKSTAKRSPKAPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSTIRKIK
SSKNSAANKELKKKPKVKDNKKERTPKKKPPPEPPVVDEAGSGLDNGDIKLTPTPDIPTT
QRNKVTTSPKFTTGKPINPKPSLPPNTDTSKETSSTPNKETTVKSKETLANKETSSKAKE
KITSAKETRSAEKTPAKDFVPTTKAPVKSTPKAESTTKSPAPTTTKEPTPTTTKKPAPTT
PKKPAPTMTTTAKDKTTEKDIIPEITTAVPKITTQETATPTEETTTESKTSTTTQVTSTT
SSKNTPKATTLAPKVMTATQKTTTTEETMNKPEETTAVPKDTATSTKVSTPRPRKPTKAP
KKPASTKKPNTIPKRKKPKTTPTPPKMTTSTMPKLHPTSSVEAMLQTTTSPNQRPNSEIV
EVNPNEDTDAAGKKPHMFPRPPVLTPIFIPGTDILVRGSNQDIAINPMLSDETNLCNGKP
VDGLTTLRNGTMVAFRGHYFWMLSPSKPPSPPRKITEVWGIPSPIDTVFTRCNCEGKTFF
FKGSQYWRFTNDIKDAGYPKQIVKGFGGLNGRIVAALSIAKYKDRPESVYFFKRGGSVQQ
YTYKQEPIKKCTGRRPAINYPVYGETTQVRRRRFERAIGPSQTHTIRIHYSPIRVSYQDK
GFLHNEVKMSSQWRGFPNVVTSAIALPNIRKPDGYDYYAFSRNQYYNIDVPSRTARVVTT
RFGRTLSNIWYNCP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]