dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F2PTR1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F2PTR1|F2PTR1_TRIEC) PH domain-containing protein {ECO:0000313|EMBL:EGE05279.1} KW=Complete proteome; Reference proteome OX=559882 OS=ringworm fungus). GN=TEQG_04435 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence length 1282
Sequence
MGRLRVPSFLSSRPDGPKGKTAAASVSFSTPDLPGAVTQTPSNQPPAAGAGPAPDQEQQT
SASPFMRRTRRLSRPIASLWTQKSAQSENEDRNQNQNLSQSQSQSESQTAPSSPPFDAEP
LVVPELEPVFAYLNNQANKLYQEGYFLKLNDLDTQGQACPDRQWVECFGQLVGTVLSIWN
ASALDTAGGQANASPSFINLADATIKMMETLPTNNETNQPLQNVVSISTAGKNRYLLHFD
SLHSLTQWTAAMRLTVFENSLLHESYTGALIAGKGKYLNGIKLILEKTTFKYEDWARVRF
GAGTPWRRCWCVISPPGEKEMQLYNRSLKKKSAYDRAPTPPKGNIKFYETRKTSKKVAPI
ATISDAYSAYAIYPQARPLVDQSTLVKVEGLVTIGENTSDGFVFVLPEMHNAVSGFETMI
RWLFPAYDAFRLYGRPNRLLADTVSPNSLMFAMPSNKRRGYLDILDVSALIHTQGSENWS
AREWRKQLKDATSRRMTSNAGSSRTSSVSGRRSGKRSSLPQRTGTVRFGSATVGPRNGEP
NSSSDTVASNSPTKPGISHTRSESENTGLPSARRGRRSPPFFENNIGEDIPEHPPAPPPE
LPQTDGPSEVDGTDSRSSPDSGAYMDNTRPADRLDIIQSLEPNPPPQGVPVSPAFSHDPR
GTPQFKPQPSPEIGHAANRMSVGTLDQLVDMNKKNGNSHGLAVAGATAAWNAATDNSKET
DNGTGQRADPRGPTLNRLNSIGASSSNYSQGSPITPSDTTSNVNVGVNINITDTPTEGQF
PVKQQNGTQNPPLHKPIARKPVAAEIPIAETASVRTASTLGSLRDNIDMDALDRIIRRPR
SPSPPPPPQPKYTFKQETAVQDDASSIVAPSYASSHKSSPSVRSIQSVQKPRMGKMKVVG
DAMPKTDDLVIGDARYKHPAVTPVEVSSDIPEVDFGPTHTYKPTARRPGTSDTMLLLSSS
HQRNPSEGTLATRGRRLSTGRLLEHLNQESNESPSPPPPTQERGRRRSVLWQPGMVQDSG
PVTPGPTSISAEQFVHDRASRSQIHLPVMPTRATPPPPRPASGDWSAYIRHQSSATHLPQ
RPHSRGPSVMLDMPARPSSRGANTILDVPARPSSRGASVILGPLDAPARPSSRGANRMLS
QPDISGHLSAREQEHVARVTGSSFLNLNNNQSPQFGSGLVSTIDARERERKAMKDGFSGQ
AVQQAIAQRQYQAQVQAQAQAQAQAQAQFQLQQQFQQPLGTSPGYAASMQFPYLPQQQPQ
QPPQAGYYAPPQGQQWQPQYHA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]