dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F2PXF6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F2PXF6|F2PXF6_TRIEC) Anucleate primary sterigmata protein A {ECO:0000313|EMBL:EGE06574.1} KW=Complete proteome; Reference proteome OX=559882 OS=ringworm fungus). GN=TEQG_05572 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence length 1563
Sequence
MDDPFVATPLAAVQSQREPHRYSSFDNQLLTLNSSSPSQLKRALEIHLAETDRRLEETSR
LGTALVRQQQELADKLKEVEQQEDEGEIGPELREKLLALERDYNEVGRESARTTFGAKPR
LLAPEDTPLDSRTPSSPAFLSSQATNSPSKVSVPSRRQRNQPASRIHDIEFATEISTSLL
TQVRQLQALLAERDEALRETNLEKSRLELEAEGFSQRIRSLDESEQRYKDENWRLETQSH
ELMAAAKEAAARENRLTANLNALTAKKNSVQRELDELKQANGKLMEEHSAAQKAHDSELH
ILRRNLNTGDAERNNLRKKVDELVGQNQELAKAVAAKLRQHESEPARNVDTETKNNDDDE
DTPENSPPPSPNKATPRHGHLESETLKSSLHHAHRMIQNLKSSIHREKSEKIELKRMLQE
ARDDLEARRNEIAAAQGSSQKRHKTKAEIFKKPPRPDMLGAGRRGITEIELDEPDWEDEE
VMEPSPTKTVRPRQTSVVYTRPRPRPRSGYVSASDAYQTANETEDGGFETAHETETATES
ENFQTGTEDMAGDSSDELTETEGRAVGQTAMPRTKPYKLRNAKAGDRSSFMSTASTSADE
DDYPYNEVHTPVQSHPPRYRLKMQRGRHARSSEETIQAGGSIGYETQSPGGSLHTPKSRV
EGGRSLFAELGEAGMGSDGEFGSPLQQPNNNPVSAESTPIRNLSCLQNKDADQPPRVAMI
DSSMMTEPWPAPAPASGTVATQTLAPQTANATTSTTSAVLVDSSTQSIVSKRPPITQTEA
MVVFSTLPSEPVKSVDMATQCSPVKSQPMAQTGPVVIHDTPPAEPSKSTAVDMATQYASA
KPQAMVQSEAMVMFDSPPVATPAEDRSRDIIAPIPVPLPITSSSPDPEPAPEPIKLEHSP
IMFEETTPVLPPVVEQPRRSSMHLAYSDVTFEQSRPVTPLPIPAALPVPCTPPKYMASSI
QTIDTPPISPPTEPEVVKPFIQLEMSSIYAESTTPVIPEPVPTIIPPVVALGTGSETEMS
PRRPRTAVHDKDTEAPSPLESSREIMPPPKFVTEGTGSMKSKQPLRLFAPASVTENGAQT
ILTSKQIDSLLLDKYVMPPPKTPESRALAPAFPGSLEEAALATPRAKTQPSSANDNFLLP
NAAAKRPGSAGSRRSTMVHPPLPPDHKQAIAAAAQRLSTESPTGGAGTMGPPVAPASAYR
SGVPASRPRTPNEQATVTTAIQGSNGSKTQHKHSGAASRRSSISSFASELDDRFNLSRSE
YGFEPGTDPRMIQAITQTMIGEFLWKYTRKPGRPDFSQTRHRRYFWVHPFTRTLYWSTQS
PQTASKAQLMAKSVAIEAVRVVTDDNPYPPGLHRKSLEVVTPGRTMRFTAATSQRHETWF
NALSYLLLRANEEEGDFVLHSTPEDGPLDFNPSLNGRSSRMTDYSRRSAASHSSRAARGM
ARGYDITPGHESPSLSVRPPDTTMKAEQARQGSVSRLSSMFKTSGMMGTFSSRRSRYGGK
RGSVDDTSQEDSAEDLRRILERQEREADKIENVRACCDGKHDVGSLSRTSRFVNSRLSNH
SHS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]