dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F2UFX7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F2UFX7|F2UFX7_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD75405.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_06480 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence length 843
Sequence
MLLVKSAVPLNHEANPVVTTSISSIDNNGAVVTSTFNISVADINEPPTDVVVHAINDTSQ
QLLQQFLVPEQPAHATTAAQPWLVGAVRVLDPDTADATADPHPFVFDVSPAGIAYIENQQ
LFVDRSALDFESQSSFVIINVTARDARDSSLAVSHQFTLLVQDLNESPSSVVPNGVSFHL
RACAPGHRGRLAHPGATLNYEVRSVFVVTVTATDQGGLSATSQILVSVQDRNDAPTTPTI
TSNRLPENTTALPFVVGTLQATDEDASQMLQFAIDSIDPPHVAPVFALDGAALVYDNTDS
PDVVVSHETTPTIAFTITVQDSGGPGDNDPPLSTTTDIVVRVVDSNDAPQGLVLINATAA
VPENAVAGTFVGTLAVTGEDMGETITFEILLGGEFLAVATPQPTACSGGAGLCTADVPPY
LLELSTSSVAENTPPGIPIATIVAFDEDRSGDEHTCQLLFGGDSALLSLLPPNTLTVAAG
MTVNFEERASLTFAVWCSDVNDGTVFATANLTLDVVDVQEPPTAVVFAASEPVPEVRSQA
IVLGTLSTIDEDAQDSTIFVLSDNDGGRLTIAQTNEVVILADAPLDFETQPARTFNVTAV
DLSGIPVSRQFTYEVADVNEPPTAPTITPTLGNGGDNSSDVTIIPVPETTAVGTVIATLA
STDPEGTPVSFVVGGQDSAFVAVDGASIVLATPVNFEGGSSSSSDARLFFWARASDGVND
SPTTHAGIAIGDVNEAPSSIVVSPTRVPENALPGAVTLSVTITDPDEDDSVVITGIATDP
ANINITIQTQPSCVSVSPQEGNNGTLAAGYTECSGAVLSLNQPFNYEQLPSFVLTLHAAV
PAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]