dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F3E4J5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F3E4J5|F3E4J5_PSEA0) Uncharacterized protein {ECO:0000313|EMBL:EGH14384.1} KW=Complete proteome OX=629259 OS=Pseudomonas amygdali pv. morsprunorum str. M302280. GN=PSYMP_27553 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas amygdali.
Sequence length 888
Sequence
MKSLPPKQSRARSVVFAEGAQWIRADFHLHTRADREFKYTGDDNFYHSNYVDALEKASIR
LGVITNHNKFDLDEFKALRKTAQNKGIALLPGVELSVNDGANGIHTLVVFSDEWIDEHDH
INPFLTSAFEGKTPAQYEQENGRSSWSLLETIKKLESYHRDFFLVFAHVEAPSGLWAELD
GGRLTDLGQNEFFRRRTLAFQKVRTHDGAGKDKPCRTKIQSWLQSWYPAELEGSDPKGID
EIGRGKTSYLKLGELSFGAVKFALGDPAARVAMEPQKHKASHIRSIHFDGGILDGQTLHF
SSELNALIGIRGSGKSSLLEAVRYALDIPRGEKVQDTKYKDELIRHTLGSGGKVTLTACD
IYGQEFTISRIFREAPNVYLGGTLQPGVSIRETVLRSPIYFGQKDLSSTGEGFETDLVEK
LVGEKLRVLREAIETQRQRVCEAAQRWLKLSNIAETKRDFNAQLTDANFRLKKFEEYGVA
DKLQKRLGFQQDATALARMAERADDFILALGSLIAEHEDELRNATSYVSKQNPDFFVAYN
AEFSNLVAGVDQLKQIEQDMRAVAARLGTKQYEFEGASKSLQEEFAQVERQLAQELKQTG
MTAIQPDDFLAQQQRKTKAEQMLDALAKQESQQTTIRDALFAEIDKLNELWLREFTTIKT
ELDRVNAVNTALQIEADFKGDKEAAISFMQQLFKGSNIRETTLRAVMEDYADFGGLLRSL
PGALVKAGSAPEVFEKTFMQYLVEFSAWQVPNRFVIRYRGKELRHHSLGQRASALLLYVL
SQRQNDVIIIDQPEDDLDNQTIYDDVIKLLREMKPHAQFIFATHNANFPVLGDAEQVHAF
QYQDEKVATQSGSIDAHPVQEAIINIMEGGQEAFNRRKEVYNLWKLQS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]