dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4G143 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4G143|F4G143_METCR) Mevalonate kinase {ECO:0000256|HAMAP-Rule:MF_00217} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_0628 OC=Metallosphaera.
Sequence length 316
Sequence
MRTVEALVPLKLTLFGEHAIVYGEPAIAMAISESMKVTVKESDRTIISSSSLHIGNIRVN
LQDMRVESDQISKALSFVIEALNYFEEKRPALINIESSVDPSVGLGTSAAVIVGVIAAYS
KFLGYDFTNLEIAKISRNVEKKVQGLGSRMDTFTTSLGGILYFPRGSENVERLSSLPEIA
SGYVKRTATTAEILRRVKTVKENGREFNEILKLIGLVVEDARDALDKMDVETLGQLMYIN
HGLLMSLGVTSPILDELVSTARNIGLPGCKMSGGGGGGSAVCLKSPKAELLLESRGFKLV
KSELNRTGVTIKEINS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]