dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4KFH9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4KFH9|F4KFH9_ARATH) Acyl-CoA N-acyltransferases (NAT) superfamily protein {ECO:0000313|EMBL:AED92340.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F5E19.140 OC=Arabidopsis.
Sequence length 236
Sequence
MSRFPRGFVENSSMEEPKIARRPTICFRPINPSDLERLEQIHRDIFPIRYESEFFQNVVN
GGDIVSWAAVDRSRPDGHSEELIGFVTAKIVLAKESEISDLIRYDSSKGEGTLVYILTLG
VVETYRKRGIAKALINEVVKYSSGIPVCRGVYLHVIAHNNPAIRLYKRMSFRCVRRLHGF
YLINGQHFDSYLFVYFINGSRSPCSPLYVQNTSIFCILNSVCCDVSLRFLHRWGYR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]