dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F4MSR4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F4MSR4|F4MSR4_STASA) Uncharacterized protein {ECO:0000313|EMBL:CBW54948.1} OX=881952 OS=Staphylococcus saprophyticus subsp. saprophyticus MS1146. GN=SSAP_P133 OC=Staphylococcus.
Sequence length 862
Sequence
MFQFGTEWIRADFHLHTNADKEFIYKGDQDRFVSDYIKKLKEENIKLGVITNHNKFHLNE
FKGLKKKARTENITLLPGVELSVKEGANGIHCLIVFKEEDWIKGNSESINQFLDEVFKGI
ENRENENTRCNKDLAGTVEALNSYNKDYVILMAHIEQKSGFLKECNGGLIESLSKNSWFK
DKVIAFQKGQTRDKMHQLERWMGYRLPYIEGSDCKSIEEIGKGKKSYIKIGDGSFDSVIL
ALRDYQNRISQLENNHSHGHIKSVEMIGGKMNNQKIYLSPELNSLIGIRGSGKSSIIEAI
RYCLDMMPSITDENYKTEVVKNLLESGGQVIVEIQDNHKKNYKVKRILGESSHVLDEDGE
EIGVTVNSILQTPLYFGQKDLSYMENGFELDLLSKLVGKKIKFFERDLTNINDQLGNHVN
QLFQLNDKLETLPDLNRSLTDIEHKIRIFEENGLNTKLSKQVNFQKDERSIENTYDRINE
FKKDLKLLLNSPNLRELDELCKQESLEVPELFSNLSKEVTSVIAVKKEIQEIIGKVDSSS
EQVKKYLEEIQAIIGSLEEEFAEIKRDIDIPNLNPDDFAKLKTNEDKIRKDIHQVNTQEE
TKDQIESKIRADLEERNQLLLQEFRVYNDEIEKINSNQGSLELSIEFKGNKESFLENLKQ
SFKGSNINQSTYRAISENHSDFSALIVDILLDDSKVTSSLVTEAQLSRVKEIIKANYNEQ
LKIRTPNKIEIQYHGKPITKHSIGQRASALVLFILSQKDNNLIMIDQPEDDLDNQIIYNE
IITKVKERKPEVQFIFATHNANIPVLGDSEQVIAVSYNEKQLSAKTGSVDNKDIQQKIVD
IMEGGQEAFNKRTQIYNSWKNV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]