dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F6RQQ0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F6RQQ0|F6RQQ0_MONDO) PR/SET domain 11 {ECO:0000313|Ensembl:ENSMODP00000024799} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PRDM11 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence length 1202
Sequence
MKAHVPAKNVAPRRPACLPGRMTENLKACLAHTQASMGEMVTVKTEVCSPRRDQEYGQPC
SGRPDPPSMEVEPKKPKGKRELIMTKSFQQVDFWFCESCQEYFVDECPNHGPPVFVSDTP
VPMGIPDRAALTIPPGMEVVKEASGQSDVRCMNEVIPKGHIFGPYEGQISTQDKSAGFFS
WLIVDKNNHYKSIDGTDETKANWMRYVVISREEREQNLMAFQHSEKIYFRVCRDIRPGER
LRVWYSEDYMKRLHSMSQETIQRNLTRGDKKLQREKPEKALDHQEDLRGPLQLTVLRHGK
SAYKRGFDEVDAHPPPKKKKIDLIFKDVLEASLETSKIEEHPLAPGTPLVLRKAPKFHTE
DVYDQCGMAISHGPQDLSRNQGEKEWKAPQGASYGPSKDTSLLEDEEEEPSSFKADSPAE
ASLASDLHELPTTSFCPNCIRLKKKIRELQAELDMLKSGKLPEPPLLPPQVPELPEFSDP
TASESVVSVPTMLEDDDQEVDSADESVSNEMITATDEPSKMSSATGRRIRRFKQEWLKKF
WFLRYSPTLNEMWCHVCRQYTVQSSRTSAFIIGSKQFKIHTIKLHSQSNLHKKCLQLYKL
RMHPEKTEEMCRNMTLLFNTAYHLALEGRPYFDFRPLAELLRKCELKVVDQYMNEGDCQI
LIHHIARALREDLVERIRQSPFLSIILDGQSDDILADTVAVYVQYTSSDGPPATEFLSLQ
ELGFSTTDSYLQALDRAFSSLGIRLQDEKPTIGLGVDGANITASLRASMFMTIRKTLPWL
LCLPFMVHRPHLEILDAISGKELPCLEELENNLKQLLSFYRYSPRLMCELRLTASTLCEE
TEFLGDIRAVRWIIGEQNVLNALIKDYLEVVAHLKDVSGQTQRADASAIALALLQFLMDY
QSIKLIYFLLDVIAVLSRLAYIFQGEYLLVSQVDDKIEEAIQEISRLADSPGEYLQEFEE
NFRESFNGVAVKNLRVAEAKFQSIREKICQKTQVILAQRFDSRSRTFVKACQVFDLAAWP
RSTEELMSYGKEDMIQIFDHLETIPSFSREICREGMDPRGSLLMEWRELKADYYTKNGFK
DLISHICKYKQRFPLLNKIIQILKVLPTSTACCEKGRVALQRVRKNNRSRLTLEQLSDLL
TIAVNGPPIANFDAKRALDSWFEEKSGNSYTLSAEVLSRMSALDQKPMLPTMDHGSEFYS
DL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]