dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F6VWS7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F6VWS7|F6VWS7_HORSE) FERM, ARH/RhoGEF and pleckstrin domain protein 2 {ECO:0000313|Ensembl:ENSECAP00000006566} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FARP2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence length 1000
Sequence
MQEKHLHVRVKLLDNTVEIFDIEPKCDGQTLLTHVWRRLNLIECDYFGLEFQNSQSCWIW
LEPMKPIIRQVRRPKNAMLRLAVKFFPPDPGQLQEEYTRYLFALQLRRDLLEERLTCTDT
TAALLTSHLLQSEIGDYDEALDREHLKVNEYLPSQERSLEKILEFHRKHTGQTPAESDFQ
VLEIARKLEMYGIRFHTASDREGAKINLAVSHMGVLVFQSTTKINTFNWSRVRKLSFKRK
RFLVKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFSRG
SSFRYSGRTQKQLADYVKDGGMKRIPYERRHSKTRLSIRALTADLPRQKSVNVLIWAQFS
LQLSNGNFCQSPLSSLCFKGTNPSVWAAGQITVHASPAPLRSGTQTPQNPAGGSLPHLEE
RIGNDKSISSLPRLPPPASGHVGGLTSSAAPASPGGGKSAYVSIGVTLGPAEQGSSPLLS
PVLSNAGGARMDDEEEPKHKRFSADEAYFIAKEILATERTYLKDLEVITVWFRSAVVKED
AMPADLMTLLFSNIDPIYEFHRGFLHEVEQRLALWEGSSNAHATGGHQRIGDVLLRNMQQ
LKEFTSYFQRHDEVLTELEKATKRSKKLEMVYKEFELQKVCYLPLNTFLLKPIQRLVHYR
LLLSRLCGHYVPGHRDHADCRDALKAITEVTSTLQHSLVRLENLQKLTELQRDLVGIENL
ITPGREFIREGCLHKLTRKGLQQRMFFLFSDMLLYTSKGVSGTSHFRIRGLLPLRGMLVE
ESESEWSVPHCFTIYAAQKTMVVAASTRLEKEKWMHDLNTAIEAAKSGADAVPASLQSTC
PDRGSSDEVSLEQESEEDARSTHSSLEGQGQHRANTTVHVCWYRNTSVSRADHIAAVENQ
LSGYLLRKFKNSTGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSVPRAADGIHK
EHVFKLQFKSHIYFFRAESKYTFGRWMEVIERASSSPGRP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]