dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F6Z539 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F6Z539|F6Z539_MONDO) Glucokinase regulator {ECO:0000313|Ensembl:ENSMODP00000019483} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=GCKR OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence length 625
Sequence
MPGTKRFQHVIETPEPGKWELSEYEASLPITEKSNPLTKDLDKANAEQIVQLLGQCDAEI
FQEEGSAMPAYQRWFLYLPIKERIFIFSLKTDLGNSYGYDPEGGLVVLSGGGTSGRMAFL
MSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVI
GISVGLSAPFVAGQMDFCMSNPDIFLPVLVGFNPINMARNDPIEDWNSTFREIAEKMQKL
QEKQKAFVLNPAIGPEGLSGSSRMKGGSATKVLLETLLLAAHKTVDRGIAASQSCLLEIL
RTFERAHKVTYSQGTKIAALMKQASTRLLSKGRVYLVGWQTLGIIAIMDGLTFKTYFQDV
RGFLIGDHSDMFNRKEELIDQGPQFSFSQEDFLSSILPSLTEIDTVLFIFTLDDNLTEVE
TLVEQVKKKTPNIQALAHSTVGQYLPSPLKKLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLRGKILYNHMLDLRLRNSKLFWRGLAMLQRFSGQPKAQCIKSLLK
AIHFPQEVSEEIQAAPISYHIQVAHEKEQVIPTALLTLLFRCSIPEAKTHLTASPSVCET
IKNILLRLGRKRSADSIDTLKMTIE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]