dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F7AJF2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F7AJF2|F7AJF2_XENTR) Plexin B1 {ECO:0000313|Ensembl:ENSXETP00000038644} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=plxnb1 OC=Silurana.
Sequence length 2090
Sequence
AFVQNNTIFNHLTLDANTGTLYVGATNSLYQLTENLAVEMLVRTGPVWDSKECLPPVSTD
CPQAQNTNNHNKLLLVVPSKRELIVCGSVYQGICESRRLGSVQTVLFRPERPVDTQYVAA
NDPNVTTVGLVALSKDGSPLLFVGRGYTSKGAGGIPPITTRNLEVGGDSEMESHSVFSYE
DTAKLAVVGRLSEYNHHFIKAFTHKSNVYFLFYRRDLKSQSREYKTYISRICPNDSHYYS
YVELPLSCRTKDKSYNLLQAAYVTQPGERLAKGVLKTDGDVLFAAFSQWQAASGKVGEES
GLCLYSMDLIDRLINQTRDTCYTKDGKAEDGREVAYIEYDVKSNCVQLPSDTLDAYPWGW
DHTPSPMASKDPREATPLFESVTTGFTAIAGHGEGEHTIAFIGDSKGYLKRVYLGGEQDT
RQYSSVGTQSNSAVLPDLLFDQEEKHLYILTQSTVMKVPLSECSTFTDCDSCLSAGDPYC
GWCVLYGKCSRSYECLRSGQKNQWLWAYDQNQQCLAVQSLSPANISKEEKRNIFLSIPDL
PALEHEESYSCFFEDFESRAVIRDTGVMCPSPDPSKTPAIKPGTDHVQVKLVLRFGEVTI
CSTEFTFYDCMAVAQLYKNAPCRGCVSSDWGCNWCIQQHHCTHKATCEEGTIIYNKLVTI
PSLLIMLSTTIPTTLPVTTPATTPTTVLQPDPSTAILDLATEDTIPDITMEPSTEEPTSR
PTTIPTTMTTTPVPVPPPTTPETQEEHPWVPTILHPTQEELTSTGQPITTPNQASSVSSL
PGSPDEFHSEIPFSEEPPTVPSEDGTEENLDQTEADDWADSASMDNDTSSFSASTILSGD
GESDGVSPSFPGILEPDLDYQFDSPGLFEMDEEELIWGPEACPCVESIQSASLLPVNVER
KITLVGKNFHHYQDQQMDYDCVLLLEGRTVVTDAVLELDPEEESKYYITCQLHQYSYSAL
QLEFNAMVFVRIQSYLRVDSAEDLYVTLYNCSVGHPDCSRCQTADPKYNCVWCGGSHPNC
MYQETCKEKVEGTCPAPLIHSIEPLSGPMEGGTRITITGSNLGQKLEDIVDTVTVAGIQC
QVDLLRYEISSRIVCVIASSLTERLGHVAVEVPGGGHGISSQVFSYFFQNPVLHSFSPTR
GPKSGGTRLTLTGTKLLTGRPSDITVLIGDIPCHIYSEMQENMLECLTGSSNSTADLQVT
IKYGDQVLRTYESPFTYTADPNITSASPAKSFISGGRMIFVSGNLEVVQAPKIRVTVSPR
ERRRKRSLSRHRRIVPETECPENALCTVEKVFFPVFPFCPLSFCINVCFILNYSYYSGGR
QSPSFPIIPTPNAFYLHPLLDSCPYRVAGGASVLSWYGENLDLAITKDEMVAMIGDGVCM
VKTLTRNHLYCEPPEKQPAPRQPQKREGVDSLPEFTVQIGRMYLVLGKVQYDTESQLTFP
LEAQIGLGVGTSFVALIVLIIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTD
LMTEMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDVPEGRRQTVEQGLVQL
SNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQ
YVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSAGEPLYMLFRGIKHQVDKGPVDCV
TGKAKYTLNDNRLLRDDVEYKTLTLNAIMQTNTGITCEEEAQGLPVKLLDCDTITQVKEK
ILDQIYKGTPYCNRPNPEALDLEWRSGLAGHLILSDEDLTSVVHGSWKRVNTLQHYKVPD
GATVALVPRLSKHIHPENHDYIPGEKTPMLEDSDEGGVRVWHLVKPTDEPELPKHRRGSL
RDRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAISH
GINDPETIHIWKTNSLPLRFWINIIKNPQFVCDVQTSDNVDAVLSVIAQTFMDSCTIADH
KLGRDSPINKLLYARDIPRYKQMVERYYSDIRQTISASDQEMNSALAELSRNCSGELNSL
VALHELYKYINKYYDQIIEALEEDPTAQKMQLGYRLQQIAAAVENKVTDL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]