dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F7G4L4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F7G4L4|F7G4L4_CALJA) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSCJAP00000041981} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LRP3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence length 766
Sequence
MDKRAAPGLEGAPARAQLAVVCLVNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSPA
WPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCG
SAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASARQMSRCDNGKCPGPW
QCNTVDECGDGSDEGNCSAPASEPPGLCPGGTFPCSGARSTRCLPVERRCDGLQDCGDGS
DEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQESRRVLLQLELRLGY
DDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQV
KGYCLPWEQPCGSSSDDDGGSAGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCE
GGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGS
DEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEF
VRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRL
GRLWNRLFHRPRAPRGQITLLTAARPSQTVLGDGLLQPAPEAAPNPPAPLMDTGSPRAAR
DGPPSAPGHVLEVGPSGPPLPLGLQDPECRPMDKDRKACREPLADSPAPVDAPREPCSAQ
DSHPQASTASSTLSPHSPEPLRVCRSPPPHCSPMLEASDDEALLVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]