dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F7QVK0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F7QVK0|F7QVK0_9LACO) MarR family transcriptional regulator {ECO:0000313|EMBL:EGM50604.1} KW=Complete proteome OX=1041521 OS=Lactobacillus salivarius GJ-24. GN=LSGJ_01150 OC=Lactobacillus.
Sequence length 115
Sequence
MPVDTENKYTLCPKFTKTFGILGRKWNGLIIEVLLEKGPQRFRNLADSVDKCSDRVMVER
LKELEDEGLVERMAQPGSTRVLYKLTPQGEDLKEIMSDIHKWSDKWYSVEDCANS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]