dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

F8AUC3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|F8AUC3|F8AUC3_BIFLN) Uncharacterized protein {ECO:0000313|EMBL:AEI97134.1} KW=Complete proteome OX=1035817 OS=Bifidobacterium longum subsp. longum KACC 91563. GN=BLNIAS_00843 OC=Bifidobacterium.
Sequence length 89
Sequence
MGVDFRTQAIHAGYEPLDNGRAAVPPIYASAAFDLGDAARGDALAGGDIDGFEYSRVANP
TVDALEKRLAALEDGIGAVAVGSGMAAAY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]