dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0HJA4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0HJA4|G0HJA4_THES4) Uncharacterized protein {ECO:0000313|EMBL:AEK73033.1} KW=Complete proteome OX=1042877 OS=Thermococcus sp. (strain CGMCC 1.5172 / 4557). GN=GQS_05665 OC=Thermococcus.
Sequence length 741
Sequence
MKKVLAAIMIVLMLIPAVGAGKIDGSVTFLSGASQSTKETREVSLALMALVSARDDVNWD
ITPDIDALVDELLDNQNQDGGWGHYFNEPSNVLDTAYAVIALTRAYPLMDVWKARDVERA
IDSGIDYLLSAKEENGWGYIPGTPVSCYPTVVALWALGENGYTYNSRTVRDAVRYLESIN
ASSCEISNYEFLALRVVAYHSTGYPLGSDVADQLKDILLKERMEVKERAMLTYALVLVSP
LDLDVARALKMLEKEGRSSDDIFYWMNTPSLMSQTEIIASTAFALMALSHPLKVTIPGEV
TNPYTMPCRELKYMQNLDGGWGLVLNEPSNEKATYYALLGLEKCYPTNESISKALEWARN
AFERDALWVQKNGRMSVGYYYALETLLRYNLLSEEEKASAVELIRNAQLDYGLWGNTVLG
PQPYETALAVKALLDLGVPANDPLIQAAKEWLLSISNGGWGTHVTTPHFSYMLKPDVLTT
ITVLEALENVATPEELEPHLQWLMDQRINGGWAYWKAYYVWQENREYPGTPSVELTVRAT
DMLLRYGHNYTSKTLDFVMNARDSGLIRNKPIETANAVLYLCRFQYIPPVSLNDVRAELD
SDIFEVIAPGMDNESVAEIVNRLSDTFSGGFIAANGTGIGEGSYIVLSNFSGYSIRVYNP
YLPFHIDGDNVTVGNVTVPLNKSVVLIPGKTPEGVVLFVFYEPENEGIAKDVFTTGFIKY
IGGSAMVLVVENGRIKVIAVG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]