dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G0HYN4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G0HYN4|G0HYN4_HALHT) Putative calcium-binding protein {ECO:0000313|EMBL:AEM58935.1} KW=Complete proteome OX=634497 OS=102182 / NCIMB 2187 / VKM B-1755). GN=HAH_4264 OC=Haloarcula.
Sequence length 1684
Sequence
MTVGPVSGMMTGTGAGPLQTAGNDIPGTSAGNQAVTTAGNEPTRTQSTQTPTSTAGNQAT
GPLSTSWNGSTEPNASAIEQLAPRENDSHPYPLVGDNQPTDPDGDGLYEDVNGDGAVNIV
DVDALSRHLGSTAAGANWSAYDYTGDNRTDVGDIQWLFVATRSTPSNDTDGDGLPDAYER
NVTKTDPRVADSDGDAVIDGAEDWDNDTLPAYREYRLGTDPRSNDTDGDRLPDGVESRLQ
SVDPTDPDTDDDGVQDSAADPDNDSLSIYNETVAGTLSNDPDTDGDGLLDGTEVHQLGTD
PLKADTDSDGLPDGAEVRLGTDPLVADSNDNGVSDGEESYTTTAANETLGVTLSLTGNGD
IGNGTTIAPQDDPRFNTSRVGNMSASPVVKLNSEQEFSSANVTLAYNETGVENESQDLAV
FTYDPEAGIFVPLNSTVDATNNTATAETTHFSTFAVFDISNWATTYNATEPVRQTDDDGV
KPVDVVMLLDASGSMKGEDPDRLAKDAAQRFTGSLLETDRAAVIEFDNFGRVKQPLTSNH
TAVNRSIRDVEYEGGNGGTDFASISAANDHFAEQSSPNRTKIIIFLTDGKSKYSDGVAEA
EQAAEQNITIYPIGFGGATRDQLSAIATATGGEVNFVDDAAGLPTVFSRVANTTTEINDT
DGDGLSDEMEREGVILGGPNGDRVTTDPKSADTDGDGLSDSREIGQYTEVSYRGRTASYY
NHLANPRQVDTDGDNLTDAEEVAGWEVQRTQSANASKGYLNVSRPDPSKRLLRSYLRSLY
RGETESYQPQISRGPDSSSSKALAITIAEQTDIDVSTLNETGHGPSPNGSYLTNITATSD
PLQPDTDHDGLADNVEHLRGTDPSRADTDGDGISDQTEFTSGTAPVLFDHRAPTVTIESI
RTKRIKNTTKVIVRQQGTTKTVRPENIKTTDSTSSGAILVAKYRYTVRLRAHDPSGVSKL
VVKPDCQYLARRAGSNLGSLMESACQGDGETIRFDNETTTSYRRVEFTVRTPIDKAGVFA
FQEFSQFFESFPVAVTAVDSNRNSRSSDYTSPGAIPELAKTAADHPATGERTEDRVIEEI
AYRSGGVWGVRQSALDLSYFLSHPWTAVTWLGNIDRLPDAALRAPETLPSAARNLQDRQN
PFDRRTETENYKLYGQNWLVGYGSGVAGSELSIGLATGGGSTVSKAAKLRKVTDTVGDAG
TAARGWTFHRSVRMASTISKGTDIKPAGTRRALGRVTIPERVRHAQRLNSPRWTRLIESL
PERATGPSRTERVSRTMRRTGDDGRQLMLQLHNSGDQRALETFIAMDETPGTQRALVRAS
REDPDVSKQDLSEALRRYDELDANERSEFDRFVEASGDNGIKFASDLDTDQAREFFSSAC
RRSPSIGAAPRPRSDRFYSIKTIGGSSLAGCGDDLTDAEETRYYSRIADVAAENEDISAG
EIFEQVSDVDDATRREAVKRLLADSGEDGVRLTRNIDSDAQEIFFDLGRNDRIDGFDDFD
EWRSAIANAEDVDAAEAGRYAERVDSAATRDNIDDVHEILDETTPRTDAVAGESGEAASA
IRYADDGAEVEMEPGQTDAYDMSVEEGGTTEYVEVKTRADNDVDYNYINTQISEMNKKHN
NALDDPELDVSENAQVLEIRTRAPSDELSSAQTAAENVLDDRVDAQVDEIRLVAENGDTV
TVEP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]