dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1KC80 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1KC80|G1KC80_ANOCA) Twinkle mtDNA helicase {ECO:0000313|Ensembl:ENSACAP00000003685} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=TWNK OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence length 666
Sequence
MWLPVRSLHHWCLRGRRVLSGRHPCRHYKKETLPSPDGPVPPASVTEIRQYLRAQDIPFH
DGYSCIHVPSVFVEEQQQVRHSYTLFIDKTTGRFVCTATLVEGNWQDFQASVELQHKGVA
GGSLEDIDKPRDHTGEDARHIWERAMPLWELLDEQETQEAKAKFGISSISNATLKRFGVR
YLRTAQALVFPWFSPRGTSLKGLKLLGVERQGETANYVENTLPRPSAYHNLFGLPLIGRR
DTEVVLTGRELDTLALHQATGLPILALPRGISCLPPGLLPYLEQFKRITLWLGEDLRSWE
AAKLFARKLNPKRCSLVQPSDQQLQPLEAFTRGLNLTKILRSALPAGHKAIISFRQLREE
VLGELANVEQVAGVKWARFPELNKLLKGHRKGELTVFTGPTGSGKTTFISEYALDLCMQG
VNTLWGSFEINNVRLAKIMLTQFAMGRLEEQLDKFDEWADRFEDLPLYFMTFHGHQNIKT
VMDTMKHAVYMYDITHIIIDNLQFMMGQEQLTVDRLAVQDYIVGTFRKFATENSCHVTLV
IHPRKEDEERELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQISKNRFDGDVGI
FPLEFSKTSLTFSSPIKAKTAKLKKMKDDNGVPPKKAPTGGASKKQRSQSPNHTTPETSP
NEPVKT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]