dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1QCY8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1QCY8|G1QCY8_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000021571} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence length 468
Sequence
MAGEGAVAKLQTEINCPICLDILRDPVTIECGHNFCRSCIERSWADVQDRFPCPVCRHPC
KERHLWSNTQLGRMVDMAKNLQIIVAKVKQQEERRLCEKHNQALTLFCEEDLKLLCPLCT
QPPDHQGHHVRPVEEAASHHRQKLRSYIEPLKKQLADLQKLLATQDRQRSELREKVEKRR
AKLASEYGSVIASIECEQAAVHSRLAAQEKHILQNLTANKAAFSDHISKLRILRKEMAET
SVLSDVKLLMNIKGVLPRCDNLEPPDVYCVKYKREEFSLPPQCSALLQIMQTFREEVTLD
PETAHANLLVSEDKKSVTFVRKKQGVHRNPKGFADDAVVLGSEGFDCGRHYWEVQVDDKP
EWAVGVCKDSLSKERKQPLLRQEDRCWTIQLQDGDYVAQGPVPVTLVLQEMPRGIGIYLD
YEMGHVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTIRALRD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]