dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1QNT8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1QNT8|G1QNT8_NOMLE) Lysozyme g-like protein {ECO:0000256|PIRNR:PIRNR001065} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LYG2 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence length 212
Sequence
MLSSVVFWGLIALIGTSRGSYPFTHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFK
SGIEAIATPSDIDNDFVNDIIARAKFYKRQSF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]