dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G1SL39 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G1SL39|G1SL39_RABIT) Lysozyme g-like protein {ECO:0000256|PIRNR:PIRNR001065} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LYG2 OC=Oryctolagus.
Sequence length 198
Sequence
GTSRASSPFLHSINPHLHPRLYHGCYGDIMTMETSGALCNIKSLLHCGIRGSEMFAEMDL
RTLKPYQTLIKEVGQRHCVDPALVAAIISRESHGGAVLQNGWDHRGLKFGLMQLDKQICH
PIGAWDSKEHLLQGVEILADRIKAIQKKFPTWNMVQHLKGGLSAFKSGIEGIDTPADIDD
DYVDDVIARAKFYRHHGY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]