dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G3NHK8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G3NHK8|G3NHK8_GASAC) Fibulin-1 {ECO:0000256|PIRNR:PIRNR036313} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=FBLN1 OC=Gasterosteus.
Sequence length 679
Sequence
MGPCALLLCSVFGLLLGQGAGQISTEDCCKDGRKRGNDNQDCASLPLISESITCRIVQEQ
CCVTVLQDNMCNTGINVAKDQGACDALFTNTCETKTTKMCCDCCLLGMATQAKNLPCDHD
LSVGYQCSLVSRACCSDGAPVANDENTSNGDSQLRDQCKGKCAHECVGNGTCTCFKGYKL
KPDAKSCEDINECLLGASNCRGGERCINTQGSFRCQREVSCGTGYELTDDNNCKDIDECE
TDIHNCGPGLECQNTQGSFRCPPKVKCGSGFIQDALGNCIDINECISQTGPCHRGQICIN
TVGSYSCQRNSVNCGRGYHLNEEGTRCVDIDECKGPEKVCAGHGCINLIGSYRCECEAGY
VFNSITRLCEDINECRHYPGRLCAHKCDNILGSYKCSCTTGFKLAADNRNCDDLNECESN
PCSQECANVYGSYQCYCRRGYQLSDMDGMTCEDIDECALPTGGHICSYRCLNTPGSFHCS
CPVSGYTVAPNGRSCQDVDECVAGTHTCTVNQSCFNVQGGFRCLSFDCPNNYRHVGETVA
RLQRSDTIRCMKSCQPNDIACVLDPMHSVSHTFISLPTFREFTRPEEIVFLRTTVPAYGS
YHLGSYDVKFDILEGNVDDAFDVIKRVENGLFVGVVRQVKSVIGPLAAVLKLSMRNLTTQ
GDSGQNIINVHVFVSEFWF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]