dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G3PVV5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G3PVV5|G3PVV5_GASAC) Neural precursor cell expressed, developmentally down-regulated 4-like {ECO:0000313|Ensembl:ENSGACP00000021744} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence length 978
Sequence
MAANYEPIYGLSEDEHETRVLRVKVIAGMDLAKKDIIGASDPYVKLSLYVAEENKELGLV
QTKTIKKTLNPKWNEEFFFRVCPQNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPA
MERPYTFKDFLLRPRSHKSRVKGYLRLKMAYLPKQGGPEEEAGEMREEAEDYGWDESADS
GSQRPQQLLPPLPPGWEEKVDNLGRTYYVNHNKRTQWKRPSNIDVISETESDNQQRQINQ
EAHRVFRSRRHISEDLENEHMEPRDLDNSWELITEEDPNESLAQSQPGTSSVSTPQPAPT
SVERDISEDLSLRLSIAPDTNGEVPGPSAALSQLSSRLRSSSMTDGVSDQTQAPPLMGSQ
TRRTRAQTVSGGEESMSPSATAYALTTPGLPPGWEERKDGKGRTYYVNHNSRTTTWTRPI
VQLTEDGASTSAAEPNNHLHEPQVRRPRSLSSPTVTLSTPLEGANNIQARRAVKDTFSNP
QSPQPSPYSSPKSQPKTQQSFLPPGWEMRIAPNGRPFFIDHNSRVTTWEDPRLKYPVHMR
TKNSIEPGELGPLPPGWEERIHSDGRTFYIDHNTKNTQWEDPRLQSPAITGPAVPYSREF
KQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSLKRPDVLKARLWIEFESEKG
LDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVA
GMAVFHGKLLDGFFIRPFYKMMLGKQISLKDMESVDSEYYNSLKWILENDPTELDLRFCI
DEDNFGQTYQVDLKPSGSDMVVTNENKKEYIDLVIQWRFVNRVQKQMNAFLEGFTELILI
DLIKIFDENELELLMCGLGDVDVNDWRQHTVYKNGYCPNHPVIQWFWKVVLLMDAEKRIR
LLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGTPEKLPRAHTCFNRLDLPTYDSFEDL
REKLLMAVENAQGFEGVD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]