dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G3PYA2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G3PYA2|G3PYA2_GASAC) LDL receptor related protein 4 {ECO:0000313|Ensembl:ENSGACP00000022592} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=LRP4 OC=Gasterosteus.
Sequence length 1512
Sequence
AGARGSAECLCGRNHFTCAVSAFGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDF
HCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFHCLNGYCIRSLWHCDGDNDCG
DNSDEQCDKRKCSDKEFRCTDGSCIAEHWYCDGDTDCKDGSDEENCPSDVMAATCSVEEF
QCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSVEFMCSSGMCINAGWRCDGEFDC
DDQSDEKNCTTSMCTAEQFRCGTGRCVRLSWRCDGEPDCSDRSDEEGCEKTESPPCAPDQ
FQCGNGRCIGQRKVCNEANDCGDGTDEHPHHDCRPRSSEGNCNQNNGGCSQKCQMVRGLV
QCTCHTGYRLMDDGKACQDVDECAEEGYCSQGCTNTEGGFQCWCVQGYEVRPDKRSCKAL
GPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHSHELVFWSDVTLDRIMKAN
LNGSNVQEVVSTGLESPGGLAIDWIHDKLYWTDSGTSRIEVANLEGTHRKVLLWQNMEKP
RAIALHPIEGKIYWTDWGNTPRIEYSNMDGSNRRVIADTHLFWPNGLTIDYAGRRMYWVD
AKHHVIERADLDGRNRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEI
IRNKLHFPMDIHTLHPQRQPAGRNRCGANNGGCSHLCLPSNKTHTCACPTGFKKVDHSNC
ANGLDKFLLFARRTDIRRVSFDTEDMSDDVIPLADVRNALALDWDAKDGYIYWTDVTTDS
INRALWNGSGQEVVVDTSLESPAGLAIDWLTNKLYWTDAGTDRIEVSNADGSMRTVLIWE
NLDRPRDIVVDPIGGFMYWTDWGANPKIERAGMDASSRIVIISSNLTWPNGLAIDYETRR
LYWADAGMKTIEFGNFDGSDRRVLIGSQLPHPFGLTVHEDKLYWTDWQSKSIQSADKLTG
LGRRTLAENLENLMDIHMFHRHRQTVRNPCALNNGGCSHLCLLAPAPKASSCACPTGINL
QTDGKTCTPGMSSFLIFARRTDIRMVSLDIPYFADVVLAVNNSMKNTIAIGVDPKEGKVY
WSDSTLKKISRSDINGKAQEEIVSTGLVTTDGLAVDAVGRKIYWTDTGTNRIEVANLDGS
MRKVLVWQNLDSPRAIALYNEMGYMYWSDWGEHAKLERSAMDGSDRAVLISNNLGWPNGL
AIDMAGSQLLWADAHTERIEAADLNGQNRRTLVTPVQHPYGLTLLGPHIYWTDWQSRSIQ
RADKNTGTNTITVRANLPGLMDIQAVDRERPLGFNRCGGRNESCTHLCLPRPSGTSCACP
TGILLKEDERSCEDSPESYLLFSNRVSVRRISLDTDDHTDVHVQVPELHNVISLDYDSVD
AKLYYTDVTLDVIRRANLDGSGMETVISQGLKTTDGLAIDWVSRNMYWTDTGRNTIEVAR
LDGTSRKVLVNNSLDEPRAIAVFPSKGFLFWTDWGHIAKIERSHLDGSDRKVLINTDLGW
PNGLTLDYDTRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]