dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G3WGQ3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G3WGQ3|G3WGQ3_SARHA) Mannose receptor C-type 1 {ECO:0000313|Ensembl:ENSSHAP00000014608} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=MRC1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence length 1449
Sequence
IRLPIIIIIISCPILNLLRDTKQFLIYNDDHKRCVNVISSSAVQTAVCNPESESQKFRWV
SNTQLMSISLKLCLGVSSKTDWVQVTLFPCDSKSDLQKWECKNDTLFGILGEDLYFNYGN
KQEKNIMLYKGSGLWSRWKIHGTSDDLCSRGYEEIYTLLGNSNGAPCVFPFKFENKWYAD
CTSAGRSDGWLWCGTTTDYEVTRLFGFCPRKFAGSESLWTKDPLTGISYQINSKSALTWH
QARKSCQQQQSELLSITEVSEQTYLTGLTNSLTTGLWIGLNSLSFNSGWQWAGYSPFRYL
NWLPGSPALEPGKSCVLLNPAKNAKWENVECSQKLGYICKKGNSSLNQFIIPSESDVPIS
CPSQWWPYAGHCYKISREPKIQKDAKTTCRKEGGDLASIHSIEEFDFIFSQLGYEDTDTL
WIGLNDLKHQMFFEWSDDTPVTFTKWLPGEPSHANNRQEDCVVMKGKNGYWADHPCEGHH
GYVCKSKPLSTPPVVEVDTGCKKGWKRHGPYCYMIGQTLSTFEVANHTCINQNAYLVTVE
DRYEQAFLTSLVGLRPEKYFWIGLSDVQNKGTFKWTIDENVQFSHWNSLMPGRKTGCVAM
KTGIAGGLWDVLKCEEKAKFVCKHWAEGVTPPPIPTTTPAPKCPDGWISSSKTNLCFKVF
GKSKYSKKTWFDARDFCRAIGGDLARITNKEDQSTIWQNIGTSNYHDVFWLGLTIANTDE
GFTWSDGSPVTYENWSYGEPNNYGNIEFCGELKADPSMRWNDINCELLRKWICHIKKGDE
LKPEPTPSPESNPPVTEDGWVIYKDYQYYFSKEKSTMENARAFCKKNFGDIVTISGESEK
KFLWKYISALDLEATYFIGLLISLDKKFSWMDGSKVDYVAWAPGEPNFANDDENCVVLYT
SSGLWNDINCGFPNAFICQRHNSSINTTASPTPLPPLGGCRWGWKLFQNKCYKIFGAKEE
ERKNWQAARKDCQGYGGNLVSIHSRKEQAFLTTELLESTYDSWIGMNDINSENKFLWTDG
RGVQYTNWAKGFPAGRRSFLSYEDVDCVVIVGGPSLEAGKWIDEICENEKGYICQTDSDP
AQPHPSTPTSGNFIRFGDSSYSVVTSKMKWKDAKEYCEGSSSQIASILDPYVNSFVWLEM
QKHNEPMWIGLNSNLTQGEYAWIDRWRMRYTNWGPGEPQVKSGCVYMDLEGFWKTAPCNE
SYQFLCKKSDVSPATEPPQLPGRCPDSEQSSWIPFSGHCYYIESSSTRSWGQALLECSRM
GASLVSIESAVESTFLTYKVEPLKSKTNFWIGMFKNVEGNWLWIDNTAVSFVNWKTGEPS
NDRNEDCVELYSSSGFWNNLYCSSYKGYICKREKIIDAKATEAIKPNDGPETRKAPKSHN
SAGIIVVVVLLILTGVGAAAYFFYKKRQVQIPQEGNFDNTLYFNTGSISGVSDTKDLMGN
IEQNEHALI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]