dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G7DRJ1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G7DRJ1|G7DRJ1_BRAJP) Cobalamin biosynthetic protein {ECO:0000313|EMBL:BAL11741.1} KW=Complete proteome OX=1037409 OS=Bradyrhizobium japonicum USDA 6. GN=BJ6T_64920 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence length 321
Sequence
MREHGGNLDLAQQRFGGRAEDWIDLSTGINRLPYPVGEVSARAWNALPSRAEIESLHQAA
QHAYRTSAPIVAMGGAQAAIQLLPQLAPRGRARILAPTYNEYAGVLSTAGWDVQEVGELD
ALAGADLAVVVNPNNPDGRRFAPQDLLALLPRVGRLVIDESFADAAPLLSLASEADRPGL
LVLRSFGKFYGLAGLRLGFALGHAADIAKLGAASGPWPVSGAAIAIGCRALRDDHWAEAT
SARLARDCARLDDIVRSLGWRLVGGAPLFRLYETPDALAAQEKLARSQIWSRVFAREPAW
LRLGLPGSEAEWTRLAEALAR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]