dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G7J2I2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G7J2I2|G7J2I2_MEDTR) Transmembrane protein, putative {ECO:0000313|EMBL:AES72089.2} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_3g085990 OC=Trifolieae; Medicago.
Sequence length 237
Sequence
MEHQHNIQAMLSYQMLIEPLYPNPTTDMDIRMNDLRLKYRTYMVEMDVDYGAIMLPMMFS
NDFGDQIQQCAALVDPNNNQFEVLVERNNQGIYLTWGWHAMRDFYKLHLGAWITIVWMGN
GRFDIRVKNRFGRRVRYPTFTPPMEFKVEPNAVPLTYEKKLGCEDVASGCLVWFIAFACY
LWDCTLQFSMTPRPNFKIGGGWDRMVKARKIKEGARVVVAAPAMGMNLTLFITWIRQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]