dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G8LV12 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G8LV12|G8LV12_CLOCD) Putative beta-xylosidase {ECO:0000313|EMBL:AEV69589.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_3058 OC=Ruminiclostridium.
Sequence length 609
Sequence
MKKRLVKICVLVMVTAALVCCTINFSAEIILAVDFNTMLDGYNSMGTMQLLSTDSETSKI
RLQSYNYPSMYIRHNNFIARIDEKVSPEEDAQWRLVKGLANQGEGYVSIESVNYPGYYLR
HYDYKLRLEKNDGSSIFAADATFKVVQGLADTSCISFQSYNYPTRYIRHYEKLLRIDEIV
TDLDRMDATYRLFDDSVVLPDPNEPEGAVIVTNPVVIQRADPWVYRHTDGYYYMTASVPE
YDRIELRRAKTIQGLASATPKTIWRRPSSGVMGGHIWAPEIHFIEGKWYIYFSAGTSSNK
FDIRLYVLECADSNPIDGTWIERGQLKTNWESFTLDATTFEHNGVRYLVWAQKDPNIDSN
SNIYIAKMNGPFAITGKQVMISTPEYPWEKVGYKVNEGPAVIKKNGRIFITYSASATDSN
YCMGLLTASDTSNLLDPNSWKKSPSPVFQSNDSTGQYGPGHNSFTTSPDGKVDIMIYHAR
NYKNIIGDPLYDPNRHTRAQRVDWNDDGTPNFGIPVADGRIEIYIPPTDIPDPINFIYGD
LNGDKAVNAIDYALMKRILLGMSGELLSDDWEKAADLNMDGSINSIDFALLKKYLLGMLK
TLPYTNTAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]