dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

G8M2S8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|G8M2S8|G8M2S8_CLOCD) Uncharacterized protein {ECO:0000313|EMBL:AEV68192.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_1556 OC=Ruminiclostridium.
Sequence length 281
Sequence
MRKSKLAISTLFLSFSLLFNGFSVMAEQMKPIVDNFILGDINGDGYIDSNDYGMLKLYLL
GFIKDFSYKHGFQAADVNSDGNVNSIDFAIFKRYLLGMITDFPQTPIPTPFATPKPPVTQ
AEGYEIERKFLIDPNKIPYDLDFLDKYEITQSYISFSPEIRLRNVDGTRFYLTVKANVDS
NGLIREERNFWMTEEEYNNLFKKIEGNVIYKARYQGLDEHRRIFAIDIFKGDLEGLAYYE
MEFPNEELANSYIPPSWVGKEVTSDKRYKNGSLAQFGIPKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]